PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G046000.1
Common NamePHAVU_004G046000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 350aa    MW: 39192.7 Da    PI: 5.955
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G046000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.68.8e-163683148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
  Phvul.004G046000.1 36 KGLWSPEEDEKLIRYMITKGQGCWSDIARNAGLQRCGKSCRLRWINYL 83
                        678*******************************************97 PP

2Myb_DNA-binding52.41.2e-1689133147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg+++++E+el+++++  lG++ W+ Ia++++ gRt++++k++w++ 
  Phvul.004G046000.1  89 RGAFSPQEEELIIHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 133
                         89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.43183IPR017930Myb domain
SuperFamilySSF466892.09E-2834130IPR009057Homeodomain-like
SMARTSM007175.4E-133585IPR001005SANT/Myb domain
PfamPF002493.0E-143683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-233790IPR009057Homeodomain-like
CDDcd001672.72E-113983No hitNo description
PROSITE profilePS5129426.12684138IPR017930Myb domain
SMARTSM007171.8E-1688136IPR001005SANT/Myb domain
PfamPF002493.0E-1589133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2691138IPR009057Homeodomain-like
CDDcd001679.24E-1291134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MRKPDIMGKD KLNTSSSTTT TTINTTNNST KSKLRKGLWS PEEDEKLIRY MITKGQGCWS  60
DIARNAGLQR CGKSCRLRWI NYLRPDLKRG AFSPQEEELI IHLHSILGNR WSQIAARLPG  120
RTDNEIKNFW NSTLKKRLKM SNNNNTTSSP NNSDSSDPRD VMGGIMPMNE HDLMTMCMDS  180
SSSTSSSSMH SMQANMALTD QFDPFPLLSN RYDMTTGAAG FLDNMAACLT QVGMADHDDG  240
VVHGDYGALE PNKMGLESDF SLPPLESRSN IEDNSTTPID VKTHNNNHFK NSCFNNTDLH  300
IQTSNNVVAE DMFGFGNHHG QGENFRMGEW DFEGLMQDMS YFPSLDFQV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28341385108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133139LKKRLKM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007151435.10.0hypothetical protein PHAVU_004G046000g
SwissprotQ9LXV22e-67MYB46_ARATH; Transcription factor MYB46
TrEMBLV7BZV20.0V7BZV2_PHAVU; Uncharacterized protein
STRINGGLYMA19G05080.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.13e-73myb domain protein 83